PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01700.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 254aa    MW: 29043.6 Da    PI: 6.18
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01700.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.3e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g WT+eEd+ lv +++++G  +W++ +++ g+ R++k+c++rw++yl
  Rsa1.0_01700.1_g00005.1 14 KGEWTAEEDQNLVAYINEHGVSDWRSLPKRAGLQRCGKSCRLRWLNYL 61
                             799*******************************************97 PP

2Myb_DNA-binding55.11.7e-1767111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg++T +E+e ++++++ lG++ W++Ia++m  +Rt++++k++w++ 
  Rsa1.0_01700.1_g00005.1  67 RGKFTRQEEEEIIKLHTVLGNR-WAAIAKEMD-NRTDNDIKNHWNSC 111
                              89********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.33961IPR017930Myb domain
SuperFamilySSF466896.97E-2911108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002493.1E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-231568IPR009057Homeodomain-like
CDDcd001677.51E-101661No hitNo description
PROSITE profilePS5129425.81762116IPR017930Myb domain
SMARTSM007171.0E-1466114IPR001005SANT/Myb domain
PfamPF002496.7E-1567111IPR001005SANT/Myb domain
CDDcd001674.16E-969109No hitNo description
Gene3DG3DSA:1.10.10.607.2E-2469116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRKKWIDGD GMKKGEWTAE EDQNLVAYIN EHGVSDWRSL PKRAGLQRCG KSCRLRWLNY  60
LRPGIKRGKF TRQEEEEIIK LHTVLGNRWA AIAKEMDNRT DNDIKNHWNS CLKKRLLRKG  120
IDPMTHNPII NNLTVTTTNE ECGSSSTTTS SSTSSPSGSA CLLNKLAAGI SSRQHVLGRI  180
KGILLEPRIT SSDQDEKEEL KSDHKIGGEE EQDDFLIWDD EEVRRFMGTD EMEYETTPYI  240
SLFYESTHVL DDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602606.11e-169PREDICTED: transcription factor MYB34-like isoform X1
SwissprotQ9FLR12e-56MYB29_ARATH; Transcription factor MYB29
TrEMBLA0A0D3DTQ71e-159A0A0D3DTQ7_BRAOL; Uncharacterized protein
STRINGBra016546.1-P1e-139(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.11e-107myb domain protein 47